Iright
BRAND / VENDOR: Proteintech

Proteintech, 67255-1-Ig, Nanog Monoclonal antibody

CATALOG NUMBER: 67255-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Nanog (67255-1-Ig) by Proteintech is a Monoclonal antibody targeting Nanog in WB, ELISA applications with reactivity to human samples 67255-1-Ig targets Nanog in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, HuH-7 cells, MDA-MB-231 cells, MCF-7 cells, T-47D cells, NCCIT cells, JAR cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants could recognized by NANOG, one is normal form (~39kd), the other is post-translation modified form (~48kd) (21136380 ). Nanog exists two isoforms with molecular weight 34.4 kDa and 31.9 kDa. (PMID: 21969378) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21364 Product name: Recombinant human NANOG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC160187 Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Predict reactive species Full Name: Nanog homeobox Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC160187 Gene Symbol: Nanog Gene ID (NCBI): 79923 RRID: AB_2882529 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9S0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924