Iright
BRAND / VENDOR: Proteintech

Proteintech, 67268-1-Ig, TRIM9 Monoclonal antibody

CATALOG NUMBER: 67268-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM9 (67268-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM9 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 67268-1-Ig targets TRIM9 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: rat brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa. Specification Tested Reactivity: Human, Mouse, Rat, Pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27856 Product name: Recombinant human TRIM9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC013414 Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR Predict reactive species Full Name: tripartite motif-containing 9 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 90 kDa, 79 kDa, 61 kDa GenBank Accession Number: BC013414 Gene Symbol: TRIM9 Gene ID (NCBI): 114088 RRID: AB_2882538 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9C026 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924