Iright
BRAND / VENDOR: Proteintech

Proteintech, 67272-1-Ig, Granzyme K Monoclonal antibody

CATALOG NUMBER: 67272-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Granzyme K (67272-1-Ig) by Proteintech is a Monoclonal antibody targeting Granzyme K in IHC, IF-P, ELISA applications with reactivity to human samples 67272-1-Ig targets Granzyme K in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Granzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27297 Product name: Recombinant human GZMK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 85-215 aa of BC035802 Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG Predict reactive species Full Name: granzyme K (granzyme 3; NK tryptase II) Calculated Molecular Weight: 29 kDa GenBank Accession Number: BC035802 Gene Symbol: GZMK Gene ID (NCBI): 3003 RRID: AB_2882541 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49863 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924