Iright
BRAND / VENDOR: Proteintech

Proteintech, 67274-1-Ig, WWP2 Monoclonal antibody

CATALOG NUMBER: 67274-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WWP2 (67274-1-Ig) by Proteintech is a Monoclonal antibody targeting WWP2 in WB, IHC, ELISA applications with reactivity to Human, Rat samples 67274-1-Ig targets WWP2 in WB, IHC, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, LNCap cells, MCF-7 cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WWP2 (WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes (PMID:21532586). WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells (PMID:15047715). Specification Tested Reactivity: Human, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2835 Product name: Recombinant human WWP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC013645 Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT Predict reactive species Full Name: WW domain containing E3 ubiquitin protein ligase 2 Calculated Molecular Weight: 870 aa, 99 kDa Observed Molecular Weight: 100-115 kDa GenBank Accession Number: BC013645 Gene Symbol: WWP2 Gene ID (NCBI): 11060 RRID: AB_2882543 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00308 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924