Iright
BRAND / VENDOR: Proteintech

Proteintech, 67286-1-Ig, Glucagon Monoclonal antibody

CATALOG NUMBER: 67286-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Glucagon (67286-1-Ig) by Proteintech is a Monoclonal antibody targeting Glucagon in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 67286-1-Ig targets Glucagon in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human pancreas tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue, human pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:15000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Glucagon is a 29-amino acid peptide hormone secreted from the pancreatic alpha cells with a powerful stimulatory effect on hepatic glucose production acting to increase plasma glucose levels. Glucagon is best known as the counter-regulatory hormone to INS, and normal glucose homeostasis depends largely on the balanced secretion of INS and glucagon from the pancreatic beta and alpha cells, respectively.The regulation of glucose metabolism by glucagon is mediated by its direct action on the peripheral tissues such as the liver and also by the brain. Glucagon is also released postprandially in a transient manner, which was shown to be involved in inhibition of food intake via reduction of meal size. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10629 Product name: Recombinant human Glucagon protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of BC005278 Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Predict reactive species Full Name: glucagon Calculated Molecular Weight: 180 aa, 21 kDa GenBank Accession Number: BC005278 Gene Symbol: Glucagon Gene ID (NCBI): 2641 RRID: AB_2882552 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924