Iright
BRAND / VENDOR: Proteintech

Proteintech, 67289-1-Ig, ERN2 Monoclonal antibody

CATALOG NUMBER: 67289-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERN2 (67289-1-Ig) by Proteintech is a Monoclonal antibody targeting ERN2 in WB, IHC, ELISA applications with reactivity to Human samples 67289-1-Ig targets ERN2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: JAR cells, A549 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29452 Product name: Recombinant human ERN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 452-563 aa of BC157113 Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV Predict reactive species Full Name: endoplasmic reticulum to nucleus signaling 2 Observed Molecular Weight: 102 kDa GenBank Accession Number: BC157113 Gene Symbol: ERN2 Gene ID (NCBI): 10595 RRID: AB_2882555 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q76MJ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924