Proteintech, 67296-1-Ig, DOCK1 Monoclonal antibody

Size: 20ul / 150ul The DOCK1 (67296-1-Ig) by Proteintech is a Monoclonal antibody targeting DOCK1 in WB, ELISA applications with reactivity to human, mouse, rat samples 67296-1-Ig targets DOCK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HSC-T6 cells, HepG2 cells, 4T1 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DOCK1, also named as DOCK180, belongs to the DOCK family. It is involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. DOCK1 functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18069 Product name: Recombinant human DOCK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1565-1865 aa of BC146857 Sequence: KDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ Predict reactive species Full Name: dedicator of cytokinesis 1 Calculated Molecular Weight: 1865 aa, 215 kDa Observed Molecular Weight: 215 kDa GenBank Accession Number: BC146857 Gene Symbol: DOCK1 Gene ID (NCBI): 1793 RRID: AB_2882560 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14185 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.