Iright
BRAND / VENDOR: Proteintech

Proteintech, 67331-1-Ig, KL Monoclonal antibody

CATALOG NUMBER: 67331-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KL (67331-1-Ig) by Proteintech is a Monoclonal antibody targeting KL in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67331-1-Ig targets KL in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27838 Product name: Recombinant human KL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-184 aa of NM_004795 Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG Predict reactive species Full Name: klotho Calculated Molecular Weight: 116 kDa Observed Molecular Weight: 125-135 kDa GenBank Accession Number: NM_004795 Gene Symbol: KL Gene ID (NCBI): 9365 RRID: AB_2882590 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UEF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924