Iright
BRAND / VENDOR: Proteintech

Proteintech, 67340-1-Ig, N-PAC Monoclonal antibody

CATALOG NUMBER: 67340-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The N-PAC (67340-1-Ig) by Proteintech is a Monoclonal antibody targeting N-PAC in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 67340-1-Ig targets N-PAC in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7133 Product name: Recombinant human N-PAC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 133-484 aa of BC064940 Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH Predict reactive species Full Name: cytokine-like nuclear factor n-pac Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC064940 Gene Symbol: N-PAC Gene ID (NCBI): 84656 RRID: AB_2882598 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q49A26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924