Iright
BRAND / VENDOR: Proteintech

Proteintech, 67349-1-Ig, SRY Monoclonal antibody

CATALOG NUMBER: 67349-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRY (67349-1-Ig) by Proteintech is a Monoclonal antibody targeting SRY in WB, ELISA applications with reactivity to human, rat samples 67349-1-Ig targets SRY in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: LNCaP cells, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SRY (sex-determining region Y protein) is a tran-scriptional activator required for male sex determination in mammals. This protein, also referred to as testis-determining factor (TDF), is an HMG box protein that initiates the formation of testis from undifferentiated gonad. The DNA-binding activity of SRY is required for normal testis formation. This DNA-binding activity is thought to be regulated by PKA, which phosphorylates SRY in vivo. Mutations in SRY have been associated with 46,XY gonadal dysgenesis, in which the gonads fail to develop in XY phenotypic females. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12610 Product name: Recombinant human SRY protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC074924 Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL Predict reactive species Full Name: sex determining region Y Calculated Molecular Weight: 204 aa, 24 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC074924 Gene Symbol: SRY Gene ID (NCBI): 6736 RRID: AB_2882607 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q05066 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924