Iright
BRAND / VENDOR: Proteintech

Proteintech, 67361-1-Ig, SPAST Monoclonal antibody

CATALOG NUMBER: 67361-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPAST (67361-1-Ig) by Proteintech is a Monoclonal antibody targeting SPAST in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse samples 67361-1-Ig targets SPAST in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, NCCIT cells, HeLa cells, PC-3 cells, HepG2 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SPAST encodes a microtubule-severing protein called spastin. By severing microtubules into small segments, SPAST participates in the regeneration of neurites. Mutations in the SPAST gene (previously known as SPG4) are the most common causes of hereditary spastic paraplegia (HSP-SPG4). Mammalian cells express at least two spastin isoforms, a less-abundant full-length form (M1-spastin, 68 kDa) and a more highly expressed isoform (M87-spastin, 60 kDa) that lacks the N-terminal 86 amino acids of the full-length protein. Also, there are two additional 64 kDa and 55 kDa isoforms due to alternative splicing of SPG4 exon 4. This antibody recognizes all these isoforms of spastin. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18866 Product name: Recombinant human SPAST protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 79-278 aa of BC150260 Sequence: CQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRK Predict reactive species Full Name: spastin Calculated Molecular Weight: 616 aa, 67 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC150260 Gene Symbol: SPAST Gene ID (NCBI): 6683 RRID: AB_2882613 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924