Proteintech, 67378-1-Ig, eqRFP630/eqRFP611 Monoclonal antibody

Size: 150ul The eqRFP630/eqRFP611 (67378-1-Ig) by Proteintech is a Monoclonal antibody targeting eqRFP630/eqRFP611 in WB, ELISA applications with reactivity to recombinant protein samples 67378-1-Ig targets eqRFP630/eqRFP611 in WB, IF, ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: ag27669 Recommended dilution Western Blot (WB): WB : 1:5000-1:100000 Background Information Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy. RFP611 and RFP 630 is a basic (constitutively fluorescent) red fluorescent protein derived from Entacmaea quadricolor. This antibody is a mouse (IgG2b) monoclonal antibody raised against RFP (eqFP611), it can also recognize eqFP630. This antibody does not recognize DsRed or mRFP. Specification Tested Reactivity: recombinant protein Cited Reactivity: human, mouse, yeast Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27669 Product name: Recombinant entacmaea quadricolor Red fluorescent protein protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-231 aa of Sequence: MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL Predict reactive species Full Name: eqRFP630/eqRFP611 Calculated Molecular Weight: 26 kDa RRID: AB_2882625 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8ISF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.