Iright
BRAND / VENDOR: Proteintech

Proteintech, 67380-1-Ig, TH1L Monoclonal antibody

CATALOG NUMBER: 67380-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TH1L (67380-1-Ig) by Proteintech is a Monoclonal antibody targeting TH1L in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to Human, mouse, rat samples 67380-1-Ig targets TH1L in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, HeLa cells, HepG2 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Positive FC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24894 Product name: Recombinant human TH1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-590 aa of BC014952 Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN Predict reactive species Full Name: TH1-like (Drosophila) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC014952 Gene Symbol: TH1L Gene ID (NCBI): 51497 RRID: AB_2882627 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IXH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924