Proteintech, 67382-1-Ig, TUSC3 Monoclonal antibody

Size: 20ul / 150ul The TUSC3 (67382-1-Ig) by Proteintech is a Monoclonal antibody targeting TUSC3 in WB, ELISA applications with reactivity to Human samples 67382-1-Ig targets TUSC3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TUSC3 (tumor suppressor candidate 3), originally named N33, is a potential tumor supressor gene. Decreased expression of TUSC3 has been found in various cancers, including prostate cancer, pancreas cancer and ovary cancer. TUSC3 also known as OST3A, is identified as a part of the oligosaccharyl-transferase (OST) complex and plays a crucial role in protein N-glycosylation. TUSC3 mutations have been found in families with non-syndromic autosomal recessive mental retardation. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9197 Product name: Recombinant human TUSC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-199 aa of BC010370 Sequence: KENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYS Predict reactive species Full Name: tumor suppressor candidate 3 Calculated Molecular Weight: 347 aa, 40 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC010370 Gene Symbol: TUSC3 Gene ID (NCBI): 7991 RRID: AB_2882629 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13454 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.