Proteintech, 67384-1-Ig, ARID4B Monoclonal antibody

Size: 20ul / 150ul The ARID4B (67384-1-Ig) by Proteintech is a Monoclonal antibody targeting ARID4B in WB, ELISA applications with reactivity to Human samples 67384-1-Ig targets ARID4B in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: T-47D cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21485 Product name: Recombinant human ARID4B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 406-523 aa of BC130418 Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE Predict reactive species Full Name: AT rich interactive domain 4B (RBP1-like) Calculated Molecular Weight: 1312 aa, 148 kDa GenBank Accession Number: BC130418 Gene Symbol: ARID4B Gene ID (NCBI): 51742 RRID: AB_2918489 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q4LE39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.