Proteintech, 67390-1-Ig, Profilin 1 Monoclonal antibody

Size: 20ul / 150ul The Profilin 1 (67390-1-Ig) by Proteintech is a Monoclonal antibody targeting Profilin 1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67390-1-Ig targets Profilin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HAP1, HSC-T6 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HAP1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29206 Product name: Recombinant human PFN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006768 Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Predict reactive species Full Name: profilin 1 Calculated Molecular Weight: 140 aa, 15 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC006768 Gene Symbol: Profilin 1 Gene ID (NCBI): 5216 RRID: AB_2882634 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07737 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.