Iright
BRAND / VENDOR: Proteintech

Proteintech, 67392-1-Ig, PPP4R1 Monoclonal antibody

CATALOG NUMBER: 67392-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP4R1 (67392-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP4R1 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67392-1-Ig targets PPP4R1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, mouse liver tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26750 Product name: Recombinant human PPP4R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 331-520 aa of BC060829 Sequence: NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS Predict reactive species Full Name: protein phosphatase 4, regulatory subunit 1 Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC060829 Gene Symbol: PPP4R1 Gene ID (NCBI): 9989 RRID: AB_2882636 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8TF05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924