Iright
BRAND / VENDOR: Proteintech

Proteintech, 67423-1-Ig, MAP1B Monoclonal antibody

CATALOG NUMBER: 67423-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAP1B (67423-1-Ig) by Proteintech is a Monoclonal antibody targeting MAP1B in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67423-1-Ig targets MAP1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Microtubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17709 Product name: Recombinant human MAP1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 414-567 aa of BC141853 Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK Predict reactive species Full Name: microtubule-associated protein 1B Calculated Molecular Weight: 2468 aa, 271 kDa GenBank Accession Number: BC141853 Gene Symbol: MAP1B Gene ID (NCBI): 4131 RRID: AB_2918490 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924