Iright
BRAND / VENDOR: Proteintech

Proteintech, 67427-1-Ig, KLK11 Monoclonal antibody

CATALOG NUMBER: 67427-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLK11 (67427-1-Ig) by Proteintech is a Monoclonal antibody targeting KLK11 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 67427-1-Ig targets KLK11 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: TT cells, DU 145 cells, pig brain tissue, LNCaP cells, PC-3 cells, Jurkat cells, rat brain tissue, A431 cells, HaCaT cells, HT-29 cells, SW 1990 cells, mouse brain tissue, rat skin tissue Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information KLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29895 Product name: Recombinant human KLK11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 58-250 aa of BC022068 Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN Predict reactive species Full Name: kallikrein-related peptidase 11 Calculated Molecular Weight: 250 aa, 27 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC022068 Gene Symbol: KLK11 Gene ID (NCBI): 11012 RRID: AB_2882666 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UBX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924