Iright
BRAND / VENDOR: Proteintech

Proteintech, 67439-1-Ig, SOX9 Monoclonal antibody

CATALOG NUMBER: 67439-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOX9 (67439-1-Ig) by Proteintech is a Monoclonal antibody targeting SOX9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 67439-1-Ig targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, Caco-2 cells, human placenta tissue, NCCIT cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, rabbit, canine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28620 Product name: Recombinant human SOX9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 209-509 aa of BC007951 Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP Predict reactive species Full Name: SRY (sex determining region Y)-box 9 Calculated Molecular Weight: 509 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC007951 Gene Symbol: SOX9 Gene ID (NCBI): 6662 RRID: AB_2882675 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P48436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924