Iright
BRAND / VENDOR: Proteintech

Proteintech, 67461-1-Ig, Arfaptin-1 Monoclonal antibody

CATALOG NUMBER: 67461-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Arfaptin-1 (67461-1-Ig) by Proteintech is a Monoclonal antibody targeting Arfaptin-1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67461-1-Ig targets Arfaptin-1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, RAW 264.7 cells, HepG2 cells, Jurkat cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12097 Product name: Recombinant human ARFIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-373 aa of BC103759 Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ Predict reactive species Full Name: ADP-ribosylation factor interacting protein 1 Calculated Molecular Weight: 373 aa, 42 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC103759 Gene Symbol: Arfaptin-1 Gene ID (NCBI): 27236 RRID: AB_2882691 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P53367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924