Iright
BRAND / VENDOR: Proteintech

Proteintech, 67466-1-Ig, PSMG3 Monoclonal antibody

CATALOG NUMBER: 67466-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PSMG3 (67466-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMG3 in WB, IF/ICC, ELISA applications with reactivity to human samples 67466-1-Ig targets PSMG3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, K-562 cells, HL-60 cells, A549 cells, Hela cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8384 Product name: Recombinant human PSMG3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species Full Name: proteasome (prosome, macropain) assembly chaperone 3 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC004308 Gene Symbol: PSMG3 Gene ID (NCBI): 84262 RRID: AB_2882695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BT73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924