Iright
BRAND / VENDOR: Proteintech

Proteintech, 67467-1-Ig, SLC25A12 Monoclonal antibody

CATALOG NUMBER: 67467-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A12 (67467-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A12 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67467-1-Ig targets SLC25A12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, A431 cells, Jurkat cells Positive IHC detected in: mouse brain tissue, human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information SLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484). Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13576 Product name: Recombinant human SLC25A12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 326-678 aa of BC016932 Sequence: SAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGLYKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier, Aralar), member 12 Calculated Molecular Weight: 75 kDa, 63 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC016932 Gene Symbol: SLC25A12 Gene ID (NCBI): 8604 RRID: AB_2882696 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924