Iright
BRAND / VENDOR: Proteintech

Proteintech, 67471-1-Ig, PLCL2 Monoclonal antibody

CATALOG NUMBER: 67471-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLCL2 (67471-1-Ig) by Proteintech is a Monoclonal antibody targeting PLCL2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67471-1-Ig targets PLCL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PLCL2, a novel phospholipase C-like protein, is expressed in lymphocytes and platelets. The expression of PLCL2 is associated with the proliferation of mature B cells in the immune system. PLCL2 is a new susceptibility loci for myocardial infarction. It has been shown that PLCL2 plays a key role in the pathogenesis of atherosclerosis and systemic sclerosisit. There are three isoforms of PLCL2 protein and 67471-1-Ig antibody detects the 126 kDa band in SDS-PAGE. (PMID: 24916648, 25880423) Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11461 Product name: Recombinant human PLCL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 653-1001 aa of BC036392 Sequence: VDPYVYVEIHGIPADCAEQRTKTVHQNGDAHIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPRKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE Predict reactive species Full Name: phospholipase C-like 2 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: BC036392 Gene Symbol: PLCL2 Gene ID (NCBI): 23228 RRID: AB_2882700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UPR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924