Iright
BRAND / VENDOR: Proteintech

Proteintech, 67530-1-Ig, SLC2A9 Monoclonal antibody

CATALOG NUMBER: 67530-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC2A9 (67530-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC2A9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67530-1-Ig targets SLC2A9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: SMMC-7721 cells, pig liver tissue, HepG2 cells, L02 cells, HuH-7 cells, rat liver tissue, mouse liver tissue, rabbit liver tissue, HSC-T6 cells Positive IHC detected in: human liver tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human hepatocirrhosis tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 9 Calculated Molecular Weight: 540 aa, 59 kDa Observed Molecular Weight: 56-59 kDa GenBank Accession Number: BC018897 Gene Symbol: SLC2A9 Gene ID (NCBI): 56606 RRID: AB_2882749 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NRM0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924