Iright
BRAND / VENDOR: Proteintech

Proteintech, 67554-1-Ig, ATP1B3 Monoclonal antibody

CATALOG NUMBER: 67554-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP1B3 (67554-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP1B3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67554-1-Ig targets ATP1B3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HepG2 cells, human placenta tissue, THP-1 cells Positive IHC detected in: human colon tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ATP1B3 (also known as CD298) is the β3 subunit of Na+/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30127 Product name: Recombinant human ATP1B3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 63-213 aa of BC011835 Sequence: QTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLK Predict reactive species Full Name: ATPase, Na+/K+ transporting, beta 3 polypeptide Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32-43 kDa GenBank Accession Number: BC011835 Gene Symbol: ATP1B3 Gene ID (NCBI): 483 RRID: AB_2882768 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P54709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924