Iright
BRAND / VENDOR: Proteintech

Proteintech, 67555-1-Ig, CRX Monoclonal antibody

CATALOG NUMBER: 67555-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRX (67555-1-Ig) by Proteintech is a Monoclonal antibody targeting CRX in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig samples 67555-1-Ig targets CRX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat retina tissue, Y79 cells, mouse retina tissue, pig retina tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719]. Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30086 Product name: Recombinant human CRX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 166-285 aa of BC016664 Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP Predict reactive species Full Name: cone-rod homeobox Calculated Molecular Weight: 299 aa, 32 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC016664 Gene Symbol: CRX Gene ID (NCBI): 1406 RRID: AB_2882769 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43186 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924