Iright
BRAND / VENDOR: Proteintech

Proteintech, 67557-1-Ig, USP15 Monoclonal antibody

CATALOG NUMBER: 67557-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP15 (67557-1-Ig) by Proteintech is a Monoclonal antibody targeting USP15 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67557-1-Ig targets USP15 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, 4T1 cells, LNCaP cells, HEK-293 cells, HepG2 cells, K-562 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Ubiquitin is a highly conserved eukaryotic protein that is synthesized as a fusion protein precursor, either to itself or to one of two ribosomal proteins. USP15, is also named as KIAA0529,Unph-2, Unph4, encoding a human ubiquitin-specific protease (USP). The USP15 protein contains the highly conserved Cys and His boxes present in all members of he UBP family of deubiquitinating enzymes(PMID:10444327).It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5712 Product name: Recombinant human USP15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-235 aa of BC020688 Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC Predict reactive species Full Name: ubiquitin specific peptidase 15 Calculated Molecular Weight: 112 kDa Observed Molecular Weight: 112 kDa GenBank Accession Number: BC020688 Gene Symbol: USP15 Gene ID (NCBI): 9958 RRID: AB_2882771 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y4E8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924