Iright
BRAND / VENDOR: Proteintech

Proteintech, 67573-1-Ig, Serpin A12/Vaspin Monoclonal antibody

CATALOG NUMBER: 67573-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Serpin A12/Vaspin (67573-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin A12/Vaspin in WB, IF/ICC, ELISA applications with reactivity to human samples 67573-1-Ig targets Serpin A12/Vaspin in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human adipose tissue, human placenta tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30136 Product name: Recombinant human SERPINA12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-370 aa of BC040857 Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC040857 Gene Symbol: Vaspin Gene ID (NCBI): 145264 RRID: AB_2882786 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IW75 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924