Proteintech, 67581-1-Ig, Galectin 10 Monoclonal antibody

Size: 20ul / 150ul The Galectin 10 (67581-1-Ig) by Proteintech is a Monoclonal antibody targeting Galectin 10 in WB, ELISA applications with reactivity to human samples 67581-1-Ig targets Galectin 10 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Human peripheral blood leukocyte Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Background Information Galectin-10 (Gal-10), also called Charcot-Leyden Crystal (CLC) protein, is a member of the galectin superfamily of galactoside-binding lectins and is most prominently expressed in human eosinophils, where it forms the classic hexagonal bipyramidal Charcot-Leyden crystals that are considered hallmarks of eosinophilic inflammatory reactions Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18569 Product name: Recombinant human CLC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC119711 Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR Predict reactive species Full Name: Charcot-Leyden crystal protein Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC119711 Gene Symbol: Galectin 10 Gene ID (NCBI): 1178 RRID: AB_2882792 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q05315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.