Proteintech, 67590-1-Ig, VPS18 Monoclonal antibody

Size: 20ul / 150ul The VPS18 (67590-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS18 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Rat samples 67590-1-Ig targets VPS18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Specification Tested Reactivity: Human, Rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29954 Product name: Recombinant human VPS18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species Full Name: vacuolar protein sorting 18 homolog (S. cerevisiae) Calculated Molecular Weight: 110 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC001513 Gene Symbol: VPS18 Gene ID (NCBI): 57617 RRID: AB_2882798 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P253 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.