Iright
BRAND / VENDOR: Proteintech

Proteintech, 67597-1-Ig, Importin Beta Monoclonal antibody

CATALOG NUMBER: 67597-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Importin Beta (67597-1-Ig) by Proteintech is a Monoclonal antibody targeting Importin Beta in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 67597-1-Ig targets Importin Beta in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IMR-32 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A549 cells, Caco-2 cells, MDA-MB-231 cells, MOLT-4 Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Importin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23094 Product name: Recombinant human KPNB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 408-605 aa of BC003572 Sequence: QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD Predict reactive species Full Name: karyopherin (importin) beta 1 Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 95-97 kDa GenBank Accession Number: BC003572 Gene Symbol: KPNB1 Gene ID (NCBI): 3837 RRID: AB_2882803 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14974 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924