Iright
BRAND / VENDOR: Proteintech

Proteintech, 67601-1-Ig, EIF1 Monoclonal antibody

CATALOG NUMBER: 67601-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF1 (67601-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 67601-1-Ig targets EIF1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6400 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7843 Product name: Recombinant human EIF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC005118 Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Predict reactive species Full Name: eukaryotic translation initiation factor 1 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC005118 Gene Symbol: EIF1 Gene ID (NCBI): 10209 RRID: AB_2882807 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41567 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924