Iright
BRAND / VENDOR: Proteintech

Proteintech, 67608-1-Ig, MYBPC3 Monoclonal antibody

CATALOG NUMBER: 67608-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYBPC3 (67608-1-Ig) by Proteintech is a Monoclonal antibody targeting MYBPC3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67608-1-Ig targets MYBPC3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: mouse heart tissue, H9C2 cells, rabbit heart tissue, pig heart tissue Positive IHC detected in: human heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information MYBPC3 belongs to the immunoglobulin superfamily and MyBP family. MYBPC3 located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15848 Product name: Recombinant human MYBPC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-328 aa of BC151211 Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA Predict reactive species Full Name: myosin binding protein C, cardiac Calculated Molecular Weight: 1274 aa, 141 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC151211 Gene Symbol: MYBPC3 Gene ID (NCBI): 4607 RRID: AB_2882814 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924