Proteintech, 67640-1-Ig, PHLPP1 Monoclonal antibody

Size: 20ul / 150ul The PHLPP1 (67640-1-Ig) by Proteintech is a Monoclonal antibody targeting PHLPP1 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67640-1-Ig targets PHLPP1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, pig brain tissue, rat brain tissue, rabbit brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of Ser/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. Observed MW of PHLPP1 beta is 185 kDa. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18982 Product name: Recombinant human PHLPP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1068-1204 aa of BC126277 Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP Predict reactive species Full Name: PH domain and leucine rich repeat protein phosphatase Calculated Molecular Weight: 185 kDa, 134 kDa Observed Molecular Weight: 185 kDa GenBank Accession Number: BC126277 Gene Symbol: PHLPP Gene ID (NCBI): 23239 RRID: AB_2882840 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.