Proteintech, 67645-1-Ig, GSTT1 Monoclonal antibody

Size: 20ul / 150ul The GSTT1 (67645-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTT1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, pig, mouse samples 67645-1-Ig targets GSTT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, pig, mouse samples. Tested Applications Positive WB detected in: pig lung tissue, pig liver tissue, K-562 cells, rat liver tissue, mouse brain tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine. Specification Tested Reactivity: Human, pig, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8573 Product name: Recombinant human GSTT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-240 aa of BC007065 Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR Predict reactive species Full Name: glutathione S-transferase theta 1 Calculated Molecular Weight: 240 aa, 27 kDa Observed Molecular Weight: 28 kDa, 30 kDa GenBank Accession Number: BC007065 Gene Symbol: GSTT1 Gene ID (NCBI): 2952 RRID: AB_2882845 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30711 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.