Iright
BRAND / VENDOR: Proteintech

Proteintech, 67647-1-Ig, PPM1B Monoclonal antibody

CATALOG NUMBER: 67647-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPM1B (67647-1-Ig) by Proteintech is a Monoclonal antibody targeting PPM1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67647-1-Ig targets PPM1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information PPM1B can identify 4 isoforms with the WM of 36-55 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: monkey Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3871 Product name: Recombinant human PPM1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC012002 Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI Predict reactive species Full Name: protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform Calculated Molecular Weight: 479 aa, 53 kDa Observed Molecular Weight: 36, 53 kDa GenBank Accession Number: BC012002 Gene Symbol: PPM1B Gene ID (NCBI): 5495 RRID: AB_2882847 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75688 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924