Proteintech, 67657-1-Ig, Destrin Monoclonal antibody

Size: 20ul / 150ul The Destrin (67657-1-Ig) by Proteintech is a Monoclonal antibody targeting Destrin in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 67657-1-Ig targets Destrin in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, human platelet, pig rectum, rat rectum, pig brain, rat brain, mouse brain Recommended dilution Western Blot (WB): WB : 1:3000-1:20000 Background Information Destrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1402 Product name: Recombinant human DSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009477 Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV Predict reactive species Full Name: destrin (actin depolymerizing factor) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-19 kDa GenBank Accession Number: BC009477 Gene Symbol: Destrin Gene ID (NCBI): 11034 RRID: AB_2918496 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P60981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.