Proteintech, 67659-1-Ig, RAB18 Monoclonal antibody

Size: 20ul / 150ul The RAB18 (67659-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67659-1-Ig targets RAB18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, human testis tissue, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:175-1:700 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16669 Product name: Recombinant human RAB18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC015014 Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL Predict reactive species Full Name: RAB18, member RAS oncogene family Calculated Molecular Weight: 206 aa, 23 kDa GenBank Accession Number: BC015014 Gene Symbol: RAB18 Gene ID (NCBI): 22931 RRID: AB_2882856 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NP72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.