Iright
BRAND / VENDOR: Proteintech

Proteintech, 67670-1-Ig, MTHFD1 Monoclonal antibody

CATALOG NUMBER: 67670-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTHFD1 (67670-1-Ig) by Proteintech is a Monoclonal antibody targeting MTHFD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67670-1-Ig targets MTHFD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, A431 cells, A549 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24553 Product name: Recombinant human MTHFD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 536-935 aa of BC009806 Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF Predict reactive species Full Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase Calculated Molecular Weight: 101 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC009806 Gene Symbol: MTHFD1 Gene ID (NCBI): 4522 RRID: AB_2882866 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P11586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924