Proteintech, 67672-1-Ig, DVL1 Monoclonal antibody

Size: 20ul / 150ul The DVL1 (67672-1-Ig) by Proteintech is a Monoclonal antibody targeting DVL1 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples 67672-1-Ig targets DVL1 in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, ROS1728 cells, NCCIT cells, HeLa cells, MDA-MB-231 cells Positive IHC detected in: rat colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway. There are two isoforms of DVL1: 75 kDa and 73 kDa. Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26083 Product name: Recombinant human DVL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species Full Name: dishevelled, dsh homolog 1 (Drosophila) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC050454 Gene Symbol: DVL1 Gene ID (NCBI): 1855 RRID: AB_2882868 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14640 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.