Proteintech, 67673-1-Ig, RNMT Monoclonal antibody

Size: 20ul / 150ul The RNMT (67673-1-Ig) by Proteintech is a Monoclonal antibody targeting RNMT in WB, ELISA applications with reactivity to human, mouse samples 67673-1-Ig targets RNMT in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RNMT, also named as mRNA cap guanine-N7 methyltransferase or KIAA0398, is a 476 amino acid protein, which contains one mRNA cap 0 methyltransferase domain and belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family. RNMT localizes in the nucleus and is widely expressed in various tissues. RNMT as a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs and binds RNA containing 5'-terminal GpppC. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6953 Product name: Recombinant human RNMT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 128-476 aa of BC036798 Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ Predict reactive species Full Name: RNA (guanine-7-) methyltransferase Calculated Molecular Weight: 476 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC036798 Gene Symbol: RNMT Gene ID (NCBI): 8731 RRID: AB_2918497 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.