Iright
BRAND / VENDOR: Proteintech

Proteintech, 67684-1-Ig, NAGA Monoclonal antibody

CATALOG NUMBER: 67684-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAGA (67684-1-Ig) by Proteintech is a Monoclonal antibody targeting NAGA in WB, ELISA applications with reactivity to Human samples 67684-1-Ig targets NAGA in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information NAGA belongs to the glycosyl hydrolase 27 family. It removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. It is required for the breakdown of glycolipids. Biosynthetic studies performed with cultured fibroblasts indicated that the human enzyme was synthesized as a 65 kDa glycosylated precursor which was processed to a mature 48-kDa lysosomal form; both the precursor and mature forms had high mannose type oligosaccharide chains, but only the precursor's mannose residues were phosphorylated. 90-117 kDa is a homodimer of NAGA. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7225 Product name: Recombinant human NAGA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-411 aa of BC000095 Sequence: LLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ Predict reactive species Full Name: N-acetylgalactosaminidase, alpha- Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC000095 Gene Symbol: NAGA Gene ID (NCBI): 4668 RRID: AB_2882877 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17050 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924