Iright
BRAND / VENDOR: Proteintech

Proteintech, 67692-1-Ig, ASL Monoclonal antibody

CATALOG NUMBER: 67692-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ASL (67692-1-Ig) by Proteintech is a Monoclonal antibody targeting ASL in WB, ELISA applications with reactivity to Human, mouse, rat, pig samples 67692-1-Ig targets ASL in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig kidney tissue, LNCaP cells, K-562 cells, rat kidney tissue, mouse kidney tissue, pig liver tissue, rat liver tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Argininosuccinate lyase (ASL), one of the significant UC enzymes, catalyzes argininosuccinate cleavage to generate arginine and fumarate. Arginine is then catalyzed by arginase to ornithine and polyamines, which are found to promote cancer cell proliferation and growth. Importantly, ASL ectopic expression is closely associated with poor prognosis of colorectal cancer, hepatocellular. ASL is a member of the aspartase/fumarase superfamily. Enzymes of this superfamily share similar tetrameric structure and active site, though the sequence identities between different members are quite low (less than 20%). Members of this superfamily have been recognised as drug targets for microbial infections. ASL is a 464-amino-acid enzyme with a molecular mass of 49.7 kDa. (PMID: 22386318 PMID: 31018905) Specification Tested Reactivity: Human, mouse, rat, pig Cited Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30517 Product name: Recombinant human ASL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 114-464 aa of BC008195 Sequence: NDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA Predict reactive species Full Name: argininosuccinate lyase Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC008195 Gene Symbol: ASL Gene ID (NCBI): 435 RRID: AB_2882885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04424 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924