Iright
BRAND / VENDOR: Proteintech

Proteintech, 67702-1-Ig, DLD Monoclonal antibody

CATALOG NUMBER: 67702-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DLD (67702-1-Ig) by Proteintech is a Monoclonal antibody targeting DLD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67702-1-Ig targets DLD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, NIH/3T3 cells, HSC-T6 cells, HeLa cells, L02 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9680 Product name: Recombinant human DLD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 160-509 aa of BC018696 Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF Predict reactive species Full Name: dihydrolipoamide dehydrogenase Calculated Molecular Weight: 509 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC018696 Gene Symbol: DLD Gene ID (NCBI): 1738 RRID: AB_2882894 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924