Proteintech, 67708-1-Ig, HNRNPK Monoclonal antibody

Size: 20ul / 150ul The HNRNPK (67708-1-Ig) by Proteintech is a Monoclonal antibody targeting HNRNPK in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67708-1-Ig targets HNRNPK in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HuH-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information HNRNPK belongs to the heterogeneous nuclear ribonucleoprotein family of 20 proteins that participate in a wide range of key cellular functions involving many of the pathways implicated, disrupted or dysregulated in tumor development and progression. It is also a conserved pre-mRNA-binding protein that is involved in multiple processes of gene expression, including chromatin remodeling, transcription, and mRNA splicing, translation, and stability Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30093 Product name: Recombinant human HNRNPK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 114-463 aa of BC014980 Sequence: LPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein K Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC014980 Gene Symbol: HNRNPK Gene ID (NCBI): 3190 RRID: AB_2882899 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: P61978 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.