Iright
BRAND / VENDOR: Proteintech

Proteintech, 67722-1-Ig, GATA2 Monoclonal antibody

CATALOG NUMBER: 67722-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATA2 (67722-1-Ig) by Proteintech is a Monoclonal antibody targeting GATA2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67722-1-Ig targets GATA2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HUVEC cells, LNCaP cells, PC-12 cells, HepG2 cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, bEnd.3 cells Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information GATA2 is a member of GATA family of transcription factors that contains zinc fingers in DNA binding domain. GATA2 acts as a transcriptinal activator that regulates endothelin-1 expression in endothelial cells. Together with GATA3, GATA2 regulates adipocyte differentiation through molecular control of the preadpocyte-adipocyte transition. It also affect the activity of Rho inhibitor p190RhoGAP that controls capillary network formation in vitro and retinal angiogenesis in vivo. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG Predict reactive species Full Name: GATA binding protein 2 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC018988 Gene Symbol: GATA2 Gene ID (NCBI): 2624 ENSEMBL Gene ID: ENSG00000179348 RRID: AB_2882909 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P23769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924