Iright
BRAND / VENDOR: Proteintech

Proteintech, 67724-1-Ig, ILK Monoclonal antibody

CATALOG NUMBER: 67724-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ILK (67724-1-Ig) by Proteintech is a Monoclonal antibody targeting ILK in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67724-1-Ig targets ILK in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: U2OS cells, human placenta tissue, human peripheral blood platelets, rat colon tissue, mouse colon tissue, pig colon tissue, HepG2 cells, HeLa cells, HEK-293 cells, K-562 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21289 Product name: Recombinant human ILK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-451 aa of BC001554 Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD Predict reactive species Full Name: integrin-linked kinase Calculated Molecular Weight: 451 aa, 59 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC001554 Gene Symbol: ILK Gene ID (NCBI): 3611 RRID: AB_2882910 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924