Iright
BRAND / VENDOR: Proteintech

Proteintech, 67734-1-Ig, CTPS2 Monoclonal antibody

CATALOG NUMBER: 67734-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTPS2 (67734-1-Ig) by Proteintech is a Monoclonal antibody targeting CTPS2 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67734-1-Ig targets CTPS2 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, U2OS cells, HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human prostate cancer tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CTPS2 (CTP synthase 2) is also named as UTP--ammonia ligase 2 and belongs to the CTP synthase family.It catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen and constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides. This antibody specifically detects only CTPS2 and not also CTPS1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30258 Product name: Recombinant human CTPS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-373 aa of BC034986 Sequence: CGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGF Predict reactive species Full Name: CTP synthase II Calculated Molecular Weight: 586 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC034986 Gene Symbol: CTPS2 Gene ID (NCBI): 56474 RRID: AB_2882918 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924