Iright
BRAND / VENDOR: Proteintech

Proteintech, 67738-1-Ig, GOT2 Monoclonal antibody

CATALOG NUMBER: 67738-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GOT2 (67738-1-Ig) by Proteintech is a Monoclonal antibody targeting GOT2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig, chicken samples 67738-1-Ig targets GOT2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, A431 cells, rat brain, mouse brain, chicken brain, HEK-293 cells, HepG2 cells Positive IHC detected in: mouse heart tissue, rat brain tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information GOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder. Specification Tested Reactivity: Human, mouse, rat, pig, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6600 Product name: Recombinant human GOT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-430 aa of BC000525 Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK Predict reactive species Full Name: glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 39-40 kDa GenBank Accession Number: BC000525 Gene Symbol: GOT2 Gene ID (NCBI): 2806 RRID: AB_2918507 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924